PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P07020_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 525aa    MW: 57314.3 Da    PI: 8.4845
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P07020_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.72.6e-103143511954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yp+  +++ LAk++gLt +qV++WF N R +
  GSMUA_Achr5P07020_001 314 FEHflHPYPTDVDKQNLAKQTGLTRNQVSNWFINARVR 351
                            554459******************************88 PP

2BELL103.91.1e-33180249372
                   BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            +e q kk++L+s+l+eV++rYkq+++q+q+vi+sFe vagl +a pY+s+Alka+S+hF+cLk+ i++q+
  GSMUA_Achr5P07020_001 180 TEQQWKKTRLISMLDEVYRRYKQCYQQVQAVIASFESVAGLSTASPYASMALKAMSKHFKCLKNIISGQL 249
                            58899**************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.7E-27131247IPR006563POX domain
PfamPF075266.0E-31161246IPR006563POX domain
PROSITE profilePS5007112.309292355IPR001356Homeobox domain
SMARTSM003895.2E-11295359IPR001356Homeobox domain
CDDcd000861.53E-13295356No hitNo description
SuperFamilySSF466891.07E-16297361IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28298359IPR009057Homeodomain-like
PfamPF059201.9E-18312351IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MNSSSHHITA VFPLSPFAFT APLFTLFSFF IACSVESERS SEKLRASAPS LSPGKKKKRE  60
MASSAADRFV GGGGGGGDEP MLLHHPQMYD HVPQHSRREK LRFPLEGSSP PSASFLLLHD  120
ADAAPSLYPA NSLTAFLPSS SSSSREMLLD ADPPRESLMD HGVDVVAGHG TKEDRAVAGT  180
EQQWKKTRLI SMLDEVYRRY KQCYQQVQAV IASFESVAGL STASPYASMA LKAMSKHFKC  240
LKNIISGQLR QTSNKGHGDE GVSREDISSF GLLNSSNYLQ KTTNSPATFA QPHVWRPQRG  300
LPERAVSVLR AWLFEHFLHP YPTDVDKQNL AKQTGLTRNQ VSNWFINARV RLWKPMVEEV  360
HSLELRQKNK TSASGGSNCA TTDEQPQPPP SSRSNPLSSP QFQVASICRN QNSVTEGIHE  420
ELTSMRNHIQ GGPVNFVYDM SNHQHVAGGA SVVAAGGNGN GNGNGVSLTL GLHQDSGVCF  480
SEPLPLNVAR RFGLEECNDT YLVSSFGAQE RQFGKDVIGG RLLHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A3e-17301359563Homeobox protein Meis2
4xrm_B3e-17301359563Homeobox protein Meis2
4xrs_A3e-17301358158Homeobox protein Meis1
4xrs_B3e-17301358158Homeobox protein Meis1
5bng_A3e-17301359159Homeobox protein Meis2
5bng_B3e-17301359159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009399856.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLM0SWD10.0M0SWD1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P07020_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.13e-69TALE family protein